PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G194000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family DBB
Protein Properties Length: 259aa    MW: 27895 Da    PI: 4.7508
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G194000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.41.1e-06443538
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         C+ +  + ++ fC  ++  lC+ C    H+       H+
  Sevir.7G194000.1.p  4 QCDVCAAEAASVFCCADEAALCDACDRRVHRAnklagkHR 43
                        7*****************************7677777776 PP

2zf-B_box22.81.9e-076093235
            zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                        +++ C+ ++e +  lfC++++  lC++C +  H 
  Sevir.7G194000.1.p 60 KPPLCDICQERRGFLFCKEDRAILCRECDVPVHT 93
                        6789*******9*****************99884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.6E-10147IPR000315B-box-type zinc finger
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
CDDcd000215.45E-6347No hitNo description
PfamPF006431.3E-5444IPR000315B-box-type zinc finger
PROSITE profilePS501199.78359106IPR000315B-box-type zinc finger
SMARTSM003366.6E-1659106IPR000315B-box-type zinc finger
PfamPF006433.8E-660101IPR000315B-box-type zinc finger
CDDcd000213.88E-862106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MKVQCDVCAA EAASVFCCAD EAALCDACDR RVHRANKLAG KHRRFSLLHP SSSSSAAQTK  60
PPLCDICQER RGFLFCKEDR AILCRECDVP VHTANELTRR HSRFLLTGVR LSSAPVDSPA  120
PSEGEDQEEE ELENSGSPCN ADSCSGGAGA TTAASASDGS SISEYLTKTL PGWHVEDFLV  180
DDASAGACSD DALYQGEQGQ IGGLLQEAYT PWTGREQMLA DVVVTTDERA SRERWVPQMH  240
AEFAACKRAR ASPPCSYW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976398.10.0PREDICTED: B-box zinc finger protein 20-like isoform X2
SwissprotQ9LQZ71e-55BBX21_ARATH; B-box zinc finger protein 21
TrEMBLK3Y9J30.0K3Y9J3_SETIT; Uncharacterized protein
STRINGSi010870m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.11e-40salt tolerance homolog2